Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ITGA2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF

Rabbit Polyclonal Anti-ITGA2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGA2