CD49b (ITGA2) Rabbit Polyclonal Antibody

CAT#: TA338255

Rabbit Polyclonal Anti-ITGA2 Antibody

Product Images

WB Suggested Anti-ITGA2 Antibody; Titration: 1.0 ug/ml; Positive Control: HT1080 Whole Cell ITGA2 is supported by BioGPS gene expression data to be expressed in HT1080

• 

  Sample Type : HeLa cellsPrimary Antibody Dilution : 1:150Secondary Antibody : Goat anti-rabbit-Alexa Fluor 488 Secondary Antibody Dilution : 1:800Color/Signal Descriptions : Green: ITGA2 Blue: DAPIGene Name : ITGA2Submitted by : COCOLA Cinzia, Stem Cell B

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: IF, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 126 kDa
• Gene Name: integrin subunit alpha 2
• Database Link:
  NP_002194
  Entrez Gene 3673 Human
  UniProt ID P17301
• Background: This gene product belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane glycoproteins composed of a distinct alpha chain and a common beta chain. They are found on a wide variety of cell types including, T cells, fibroblasts and platelets. Integrins are involved in cell adhesion and also participate in cell-surface mediated signalling.
• Synonyms: BR; CD49B; GPIa; HPA-5; VLA-2; VLAA2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 92%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hematopoietic cell lineage, Hypertrophic cardiomyopathy (HCM), Pathways in cancer, Regulation of actin cytoskeleton, Small cell lung cancer