Primary Antibodies

Jump to Filters
View as table Download
HSP70-1A (HSPA1A) Mouse Monoclonal Antibody [Clone ID: C92F3A-5]
TA309388

USD 525.00

5 Days

Mouse Monoclonal anti-HSPA1A Antibody

Applications FC
Reactivities Human, Mouse, Rat, Bovine, dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep
Conjugation Unconjugated
HSPA1L Rabbit Polyclonal Antibody
TA335710

USD 375.00

5 Days

Rabbit Polyclonal Anti-HSPA1L Antibody

Applications WB
Reactivities Human, Lamprey, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD