Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RRAS Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rras antibody is: synthetic peptide directed towards the C-terminal region of Rat Rras. Synthetic peptide located within the following region: ASSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAP

Rabbit Polyclonal Anti-RRAS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RRAS