RRAS Rabbit Polyclonal Antibody

CAT#: TA345135

Rabbit Polyclonal Anti-RRAS Antibody - C-terminal region

Product Images

Host: Rabbit; Target Name: Rras; Sample Tissue: Rat Stomach lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Rras antibody is: synthetic peptide directed towards the C-terminal region of Rat Rras. Synthetic peptide located within the following region: ASSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: related RAS viral (r-ras) oncogene homolog
• Database Link:
  NP_006261
  Entrez Gene 361568 Rat
  UniProt ID P10301
• Background: Regulates the organization of the actin cytoskeleton.
• Synonyms: Oncogene RRAS; related RAS viral (r-ras) oncogene homolog
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction