Primary Antibodies

View as table Download

IFIH1 Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human IFIH1

Rabbit Polyclonal MDA5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MDA5 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human MDA5.

Rabbit Polyclonal MDA5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MDA5 antibody was raised against a 16 amino acid peptide from near the center of human MDA5.

Rabbit polyclonal IFIH1 (MDA5) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human IFIH1.

Goat Polyclonal Antibody against IFIH1 (MDA5)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence SNGYSTDENFRYL-C, from the N Terminus of the protein sequence according to NP_071451.2.

Rabbit Polyclonal Anti-IFIH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFIH1 antibody: synthetic peptide directed towards the middle region of human IFIH1. Synthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED

IFIH1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human IFIH1 (NP_071451.2).
Modifications Unmodified