Rabbit Polyclonal Anti-KCNK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4. Synthetic peptide located within the following region: MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH |
Rabbit Polyclonal Anti-KCNK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4. Synthetic peptide located within the following region: ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSA |
KCNK4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-90 of human KCNK4 (NP_201567.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China