KCNK4 Rabbit Polyclonal Antibody

CAT#: TA338723

Rabbit Polyclonal Anti-KCNK4 Antibody

Product Images

WB Suggested Anti-KCNK4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4. Synthetic peptide located within the following region: MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: potassium two pore domain channel subfamily K member 4
• Database Link:
  NP_201567
  Entrez Gene 50801 Human
  UniProt ID Q9NYG8
• Background: Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The encoded protein homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids. [provided by RefSeq, Jul 2008]
• Synonyms: K2p4.1; TRAAK; TRAAK1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane