Primary Antibodies

View as table Download

IL17B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL17B

Rabbit Polyclonal Anti-Il17b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Il17b antibody is: synthetic peptide directed towards the N-terminal region of Rat Il17b. Synthetic peptide located within the following region: LLAISIFLVPSQPRNTKGKRKGQGRPGPLAPGPHQVPLDLVSRVKPYARM

IL-17B Rabbit polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide from human protein at AA range: 1-50