Primary Antibodies

Jump to Filters
View as table Download
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
TA339197

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPP3CA

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the N terminal of human PPP3CA. Synthetic peptide located within the following region: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
TA349733

USD 345.00

In Stock

Rabbit Polyclonal Anti-PPP3CA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP3CA
PPP3CA Rabbit Polyclonal Antibody
TA364697

USD 380.00

4 Weeks

PPP3CA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP3CA