Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody

CAT#: TA339197

Rabbit Polyclonal Anti-PPP3CA

Product Images

WB Suggested Anti-PPP3CA Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysate

• 

  WB Suggested Anti-PPP3CA Antibody; Positive Control: Lane 1: 80ug mouse brain extractLane 2: 80ug rat brain extract; Primary Antibody Dilution: 1: 500; Secondary Antibody: IRDye 800 CW goat anti-rabbit from Li-COR Bioscience; Secondry Antibody Dilution: 1

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the N terminal of human PPP3CA. Synthetic peptide located within the following region: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: protein phosphatase 3 catalytic subunit alpha
• Database Link:
  NP_000935
  Entrez Gene 19055 MouseEntrez Gene 24674 RatEntrez Gene 5530 Human
  UniProt ID Q08209
• Background: PPP3CA belongs to the PPP phosphatase family, PP-2B subfamily. It is a calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. PPP3CA dephosphorylates HSPB1 and SSH1.
• Synonyms: CALN; CALNA; CALNA1; CCN1; CNA1; PPP2B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Axon guidance, B cell receptor signaling pathway, Calcium signaling pathway, Long-term potentiation, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Oocyte meiosis, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway