Primary Antibodies

View as table Download

Rabbit Polyclonal anti-CHIA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHIA antibody: synthetic peptide directed towards the N terminal of human CHIA. Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL

Rabbit Polyclonal anti-CHIA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHIA antibody: synthetic peptide directed towards the middle region of human CHIA. Synthetic peptide located within the following region: GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP

CHIA rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CHIA

CHIA rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CHIA

CHIA Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-368 of human CHIA (NP_001244932.1).
Modifications Unmodified

CHIA Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-368 of human CHIA (NP_001244932.1).
Modifications Unmodified