Anti-A1BG Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 150-164 amino acids of human alpha-1-B glycoprotein |
Anti-A1BG Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 150-164 amino acids of human alpha-1-B glycoprotein |
Rabbit polyclonal anti-A1BG antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human A1BG. |
Rabbit Polyclonal Anti-A1BG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-A1BG antibody: synthetic peptide directed towards the N terminal of human A1BG. Synthetic peptide located within the following region: ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG |
Rabbit Polyclonal Anti-A1BG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-A1BG antibody: synthetic peptide directed towards the C terminal of human A1BG. Synthetic peptide located within the following region: REGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTFESELS |
Anti-A1BG Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 150-164 amino acids of human alpha-1-B glycoprotein |
A1BG Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 236-495 of human A1BG (NP_570602.2). |
Modifications | Unmodified |
A1BG Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 236-495 of human A1BG (NP_570602.2). |
Modifications | Unmodified |
A1BG Rabbit polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthesized peptide derived from A1BG . at AA range: 100-180 |