A1BG Rabbit Polyclonal Antibody

CAT#: TA334284

Rabbit Polyclonal Anti-A1BG Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "A1BG"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-A1BG antibody: synthetic peptide directed towards the C terminal of human A1BG. Synthetic peptide located within the following region: REGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTFESELS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 52 kDa
Gene Name alpha-1-B glycoprotein
Background A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Synonyms A1B; ABG; GAB; HYST2477
Note Immunogen Sequence Homology: Human: 100%; Mouse: 92%; Rat: 90%; Dog: 83%; Rabbit: 77%
Reference Data
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.