Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ApoA4 Antibody

Applications WB
Reactivities Chicken, Human
Conjugation Unconjugated
Immunogen ApoA4 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of chicken ApoA4.

Goat Polyclonal Antibody against APOA4

Applications WB
Reactivities Human
Immunogen Peptide with sequence C-KEKESQDKTLSLP, from the internal region (near the C Terminus) of the protein sequence according to NP_000473.2.

Rabbit Polyclonal ApoA4 Antibody

Applications WB
Reactivities Human
Immunogen ApoA4 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human ApoA4.

Rabbit Polyclonal Anti-APOA4 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-APOA4 Antibody: synthetic peptide directed towards the C terminal of human APOA4. Synthetic peptide located within the following region: RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ

Rabbit Polyclonal Anti-APOA4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human APOA4

APOA4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 227-396 of human APOA4 (NP_000473.2).
Modifications Unmodified