Primary Antibodies

Jump to Filters
View as table Download
CDK15 Rabbit Polyclonal Antibody
TA347634

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-AL2S7 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AL2S7 Antibody: A synthesized peptide derived from human AL2S7
Cdk15 Rabbit Polyclonal Antibody
TA330719

USD 375.00

Backordered

Rabbit Polyclonal Anti-Cdk15 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cdk15 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Cdk15. Synthetic peptide located within the following region: ASFHPRGLEAASAQKLKSKRPRSNSDSFQEENLRQGLPWKKSLPFGAASS
CDK15 Rabbit Polyclonal Antibody
TA315762

USD 345.00

4 Weeks

Rabbit polyclonal anti-CDK15 (AL2S7) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human AL2S7.
CDK15 Rabbit Polyclonal Antibody
TA374554

USD 220.00

3 Weeks

CDK15 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 271-400 of human CDK15 (NP_001248365.1).
Modifications Unmodified