Rabbit Polyclonal Anti-AL2S7 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AL2S7 Antibody: A synthesized peptide derived from human AL2S7 |
Rabbit Polyclonal Anti-AL2S7 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AL2S7 Antibody: A synthesized peptide derived from human AL2S7 |
Rabbit Polyclonal Anti-Cdk15 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Cdk15 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Cdk15. Synthetic peptide located within the following region: ASFHPRGLEAASAQKLKSKRPRSNSDSFQEENLRQGLPWKKSLPFGAASS |
Rabbit polyclonal anti-CDK15 (AL2S7) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | he antiserum was produced against synthesized peptide derived from internal of human AL2S7. |
CDK15 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 271-400 of human CDK15 (NP_001248365.1). |
Modifications | Unmodified |