Cdk15 Rabbit Polyclonal Antibody

CAT#: TA330719

Rabbit Polyclonal Anti-Cdk15 Antibody

Product Images

Host: Rabbit; Target Name: Cdk15; Sample Tissue: Mouse Brain lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Cdk15 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Cdk15. Synthetic peptide located within the following region: ASFHPRGLEAASAQKLKSKRPRSNSDSFQEENLRQGLPWKKSLPFGAASS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: cyclin-dependent kinase 15
• Database Link:
  NP_001028545
  Entrez Gene 271697 Mouse
  UniProt ID Q3V3A1
• Background: Cdk15 is a Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin.
• Synonyms: ALS2CR7; PFTAIRE2; PFTK2
• Note: Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 92%; Rat: 86%; Mouse: 86%; Pig: 85%