Primary Antibodies

View as table Download

HSPE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HSPE1

Rabbit Polyclonal Anti-HSPE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HSPE1

Rabbit polyclonal anti-HSP10 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HSP10.

Rabbit Polyclonal Anti-HSP10 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSP10 Antibody: A synthesized peptide derived from human HSP10

Rabbit Polyclonal Anti-HSPE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPE1 antibody: synthetic peptide directed towards the middle region of human HSPE1. Synthetic peptide located within the following region: GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

HSPE1/HSP10/CPN10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human HSPE1/HSP10/CPN10 (NP_002148.1).
Modifications Unmodified