Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
KIAA1324 / maba1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | KIAA1324 / maba1 antibody was raised against synthetic 17 amino acid peptide from internal region of human KIAA1324. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Elephant (94%); Galago, Panda, Dog, Horse, Opossum, Platypus (88%); Mouse, Rat, Hamster, Bat, Bovine, Pig, Lizard (82%). |
Rabbit Polyclonal Anti-KIAA1324 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIAA1324 antibody: synthetic peptide directed towards the N terminal of human KIAA1324. Synthetic peptide located within the following region: PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW |
USD 345.00
In Stock
Rabbit Polyclonal Anti-KIAA1324 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KIAA1324 |
KIAA1324 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KIAA1324 |
KIAA1324 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 42-300 of human KIAA1324 (NP_001253977.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KIAA1324
Isotypes
- IgG