Rabbit Polyclonal Anti-MNX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MNX1 antibody: synthetic peptide directed towards the N terminal of human MNX1. Synthetic peptide located within the following region: AAASGTGGGGGGGGASGGTSGSCSPASSEPPAAPADRLRAESPSPPRLLA |
Rabbit Polyclonal Anti-Mnx1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for Anti-Mnx1 antibody is: synthetic peptide directed towards the middle region of Mouse Mnx1. Synthetic peptide located within the following region: QQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSK |
MNX1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MNX1 |
MNX1/HB9/HLXB9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MNX1/HB9/HLXB9. |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China