Germany
Japan
United Kingdom
China
Mnx1 Rabbit Polyclonal Antibody
Product Images
Other products for "Mnx1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-Mnx1 antibody is: synthetic peptide directed towards the middle region of Mouse Mnx1. Synthetic peptide located within the following region: QQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSK |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 41 kDa |
| Gene Name | motor neuron and pancreas homeobox 1 |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | HB9; HLXB9; HOXHB9; SCRA1 |
| Note | Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Zebrafish: 92%; Guinea pig: 92% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.