Antibodies

View as table Download

Rabbit Polyclonal Anti-MNX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MNX1 antibody: synthetic peptide directed towards the N terminal of human MNX1. Synthetic peptide located within the following region: AAASGTGGGGGGGGASGGTSGSCSPASSEPPAAPADRLRAESPSPPRLLA

Rabbit Polyclonal MNX1/HLXB9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acids 330-380 of mouse HB9 was used as the immunogen.

MNX1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 241-271 amino acids from the Central region of human MNX1

Rabbit Polyclonal Anti-Mnx1 Antibody

Applications WB
Reactivities Mouse
Immunogen The immunogen for Anti-Mnx1 antibody is: synthetic peptide directed towards the middle region of Mouse Mnx1. Synthetic peptide located within the following region: QQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSK

MNX1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MNX1

MNX1/HB9/HLXB9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MNX1/HB9/HLXB9.
Modifications Unmodified