Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 276 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal Anti-MX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MX1 antibody: synthetic peptide directed towards the C terminal of human MX1. Synthetic peptide located within the following region: KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG |
Rabbit Polyclonal Anti-MX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MX1 |
Germany
Japan
United Kingdom
China
