MX1 Rabbit Polyclonal Antibody

CAT#: TA339254

Rabbit Polyclonal Anti-MX1 Antibody

Product Images

MX1 antibody - C-terminal region validated by WB using human LCL at 1:1000

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MX1 antibody: synthetic peptide directed towards the C terminal of human MX1. Synthetic peptide located within the following region: KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: MX dynamin like GTPase 1
• Database Link:
  NP_002453
  Entrez Gene 4599 Human
  UniProt ID P20591
• Background: This gene encodes a guanosine triphosphate (GTP)-metabolizing protein that participates in the cellular antiviral response. The encoded protein is induced by type I and type II interferons and antagonizes the replication process of several different RNA and DNA viruses. There is a related gene located adjacent to this gene on chromosome 21, and there are multiple pseudogenes located in a cluster on chromosome 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
• Synonyms: IFI-78K; IFI78; MX; MxA
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Guinea pig: 93%; Horse: 86%; Mouse: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome