Rabbit Polyclonal Anti-POLR1E Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR1E antibody: synthetic peptide directed towards the N terminal of human POLR1E. Synthetic peptide located within the following region: SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL |
POLR1E rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human POLR1E |
POLR1E Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-419 of human POLR1E (NP_071935.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
