PRAF1 (POLR1E) Rabbit Polyclonal Antibody

CAT#: TA344676

Rabbit Polyclonal Anti-POLR1E Antibody - N-terminal region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human polymerase (RNA) I polypeptide E, 53kDa (POLR1E)
    • 20 ug

USD 823.00


Transient overexpression lysate of polymerase (RNA) I polypeptide E, 53kDa (POLR1E)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "POLR1E"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-POLR1E antibody: synthetic peptide directed towards the N terminal of human POLR1E. Synthetic peptide located within the following region: SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 47 kDa
Gene Name polymerase (RNA) I subunit E
Background POLR1E is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.POLR1E is the component of RNA polymerase I which synthesizes ribosomal RNA precursors.POLR1E appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.
Synonyms PAF53; PRAF1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%
Reference Data
Protein Families Transcription Factors
Protein Pathways Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.