Rabbit polyclonal anti-PSMD6 antibody
Applications | WB |
Reactivities | Human Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PSMD6. |
Rabbit polyclonal anti-PSMD6 antibody
Applications | WB |
Reactivities | Human Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PSMD6. |
Rabbit Polyclonal Anti-PSMD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMD6 antibody: synthetic peptide directed towards the N terminal of human PSMD6. Synthetic peptide located within the following region: YEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDA |
Rabbit Polyclonal Anti-PSMD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMD6 antibody: synthetic peptide directed towards the N terminal of human PSMD6. Synthetic peptide located within the following region: PLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMA |
Anti-PSMD6 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 |
Anti-PSMD6 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 |
PSMD6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMD6. |