SLC22A2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC22A2 |
SLC22A2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC22A2 |
Rabbit Polyclonal Anti-SLC22A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC22A2 Antibody: synthetic peptide directed towards the N terminal of human SLC22A2. Synthetic peptide located within the following region: MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHR |
Rabbit Polyclonal Anti-SLC22A2 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC22A2 |
SLC22A2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 44-140 of human SLC22A2 (NP_003049.2). |
Modifications | Unmodified |
SLC22A2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 44-140 of human SLC22A2 (NP_003049.2). |
Modifications | Unmodified |