Rabbit Polyclonal Anti-SMN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMN1 antibody: synthetic peptide directed towards the N terminal of human SMN1. Synthetic peptide located within the following region: KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV |
SMN1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SMN1 |
Goat Polyclonal Antibody against SMN1 / SMN2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DESENSRSPGNKSDN, from the internal region of the protein sequence according to NP_075012.1; NP_000335.1; NP_075013.1; NP_075014.1; NP_075015.1; NP_059107.1. |
Rabbit Polyclonal Anti-SMN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMN1 antibody is: synthetic peptide directed towards the C-terminal region of SMN1. Synthetic peptide located within the following region: PPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSL |
Rabbit anti SMN (Survival of motor neuron) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to C-terminus of human SMN. |
Rabbit Polyclonal Anti-SMN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SMN1 |
SMN1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-150 of human SMN1 (NP_000335.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
