SMN1 Rabbit Polyclonal Antibody

CAT#: TA343298

Rabbit Polyclonal Anti-SMN1 Antibody

Product Images

WB Suggested Anti-SMN1 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMN1 antibody is: synthetic peptide directed towards the C-terminal region of SMN1. Synthetic peptide located within the following region: PPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: survival of motor neuron 1, telomeric
• Database Link:
  NP_075012
  Entrez Gene 6606 Human
  UniProt ID Q16637
• Background: SMN1 localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein.
• Synonyms: BCD541; GEMIN1; SMA; SMA1; SMA2; SMA3; SMA4; SMA@; SMN; SMNT; T-BCD541; TDRD16A
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Guinea pig: 92%; Mouse: 85%; Rabbit: 85%; Bovine

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency