Rabbit Polyclonal Anti-SULT2B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SULT2B1 antibody: synthetic peptide directed towards the middle region of human SULT2B1. Synthetic peptide located within the following region: YSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFI |
Rabbit Polyclonal Anti-SULT2B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SULT2B1 antibody: synthetic peptide directed towards the C terminal of human SULT2B1. Synthetic peptide located within the following region: NTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQM |
Rabbit Polyclonal Anti-SULT2B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SULT2B1 antibody: synthetic peptide directed towards the N terminal of human SULT2B1. Synthetic peptide located within the following region: MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI |
Rabbit Polyclonal Anti-SULT2B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SULT2B1 |
SULT2B1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SULT2B1 |
SULT2B1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-365 of human SULT2B1 (NP_814444.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China