SULT2B1 Rabbit Polyclonal Antibody

CAT#: TA339866

Rabbit Polyclonal Anti-SULT2B1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SULT2B1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SULT2B1 antibody: synthetic peptide directed towards the N terminal of human SULT2B1. Synthetic peptide located within the following region: MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name sulfotransferase family 2B member 1
Background Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and
Synonyms HSST2
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Pathways Androgen and estrogen metabolism, Sulfur metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.