Primary Antibodies

Jump to Filters
View as table Download
TNFRSF1A Rabbit Polyclonal Antibody
TA327070

USD 275.00

3 Weeks

Rabbit anti-TNF-R1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNF-R1
TNFRSF1A Rabbit Polyclonal Antibody
TA328458

USD 285.00

In Stock

Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I
TNFRSF1A Rabbit Polyclonal Antibody
TA328457

USD 285.00

In Stock

Biotinylated Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I
TNFRSF1A Capture Mouse Monoclonal Antibody [Clone ID: TBP]
TA600021

USD 379.00

2 Weeks

TNFRSF1A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone TBP

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700021
TNFRSF1A Rabbit Polyclonal Antibody
TA311833

USD 345.00

In Stock

Rabbit polyclonal TNF Receptor-1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1.
TNFRSF1A Rabbit Polyclonal Antibody
TA330321

USD 375.00

5 Days

Rabbit Polyclonal Anti-TNFRSF1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI
TNFRSF1A Goat Polyclonal Antibody
TA311173

USD 375.00

5 Days

Goat Anti-TNFRSF1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SDHEIDRLELQNGR, from the internal region of the protein sequence according to NP_001056.1.
TNFRSF1A Rabbit Polyclonal Antibody
TA326458

USD 390.00

5 Days

Rabbit Polyclonal Anti-TNF-R1 Antibody

Reactivities Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues
TNFRSF1A Biotinylated Mouse Monoclonal Detection Antibody [Clone ID: H398]
TA700021

USD 399.00

In Stock

TNFRSF1A biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone H398

Applications ELISA, LMNX
Reactivities Human
Conjugation Biotin
Matched ELISA Pair TA600021