Primary Antibodies

Jump to Filters
View as table Download
DFFB (N-term) Rabbit Polyclonal Antibody
AP51245PU-N

USD 450.00

2 Weeks

DFFB (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human DFFB / CAD.
DFFB Rabbit Polyclonal Antibody
TA305993

USD 430.00

5 Days

Rabbit Polyclonal DFF40 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DFF40 antibody was raised against a peptide corresponding to 18 amino acids near the center of murine CAD. The immunogen is located within amino acids 130 - 180 of DFF40.
DFFB Rabbit Polyclonal Antibody
TA306008

USD 430.00

5 Days

Rabbit Polyclonal DFF40 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DFF40 antibody was raised against a peptide corresponding to amino acids 3 to 18 of human DFF40.
DFFB Rabbit Polyclonal Antibody
TA306009

USD 430.00

5 Days

Rabbit Polyclonal DFF40 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DFF40 antibody was raised against a peptide corresponding to amino acids 203 to 218 of human DFF40 .
DFFB Rabbit Polyclonal Antibody
TA340051

USD 375.00

5 Days

Rabbit Polyclonal Anti-DFFB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DFFB antibody: synthetic peptide directed towards the middle region of human DFFB. Synthetic peptide located within the following region: EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK
DFFB Rabbit Polyclonal Antibody
TA322750

USD 345.00

In Stock

Anti-DFFB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 146-160 amino acids of human DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)