Primary Antibodies

View as table Download

Rabbit polyclonal anti-ELOVL5 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ELOVL5.

Rabbit Polyclonal Anti-ELOVL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK

Rabbit Polyclonal ELOVL5 Antibody

Applications IF, IHC, WB
Reactivities Human
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

ELOVL5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 247-277 amino acids from the C-terminal region of Human ELOVL5.

ELOVL5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region ( between 270-299aa) of human ELOVL5.

Rabbit Polyclonal Anti-ELOVL5 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen HELO1 / ELOVL5 antibody was raised against synthetic 15 amino acid peptide from C-Terminus of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Panda (93%); Goat, Dog, Bat, Bovine, Rabbit, Opossum (87%); Elephant, Horse, Turkey, Chicken, Lizard (80%).

Rabbit Polyclonal Anti-ELOVL5 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HELO1 / ELOVL5 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Turkey, Chicken (100%); Elephant, Catfish (93%); Mouse, Rat, Dog, Hamster, Horse, Rabbit, Opossum, Platypus (87%); Bovine, Goat, Panda, Xenopus, Salmon (80%).

Rabbit Polyclonal Anti-ELOVL5 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen HELO1 / ELOVL5 antibody was raised against synthetic 17 amino acid peptide from internal region of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset (100%); Gibbon, Mouse, Hamster, Elephant, Rabbit (94%); Rat, Dog, Panda (88%); Bat, Bovine, Goat (82%).

Rabbit Polyclonal Anti-ELOVL5 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen HELO1 / ELOVL5 antibody was raised against synthetic 18 amino acid peptide from internal region of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Elephant, Rabbit (100%); Marmoset, Mouse, Dog (94%); Rat, Hamster, Panda (89%); Bat (83%).