ELOVL5 Rabbit Polyclonal Antibody

CAT#: TA338477

Rabbit Polyclonal Anti-ELOVL5 Antibody

Product Images

WB Suggested Anti-ELOVL5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human heart

• 

  Host: Rabbit; Target Name: ELOVL5; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ELOVL5; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml ELOVL5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Host: Rabbit; Target Name: ELOVL5; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that ELOVL5 is expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: ELOVL fatty acid elongase 5
• Database Link:
  NP_068586
  Entrez Gene 60481 Human
  UniProt ID Q9NYP7
• Background: ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000 [PubMed 10970790]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3003 AF338241.1 9-3011
• Synonyms: dJ483K16.1; HELO1; SCA38
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Pig: 92%; Goat: 92%; Bovine: 92%; Guinea pig: 85%; Horse: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Biosynthesis of unsaturated fatty acids