Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NOTCH4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NOTCH4 antibody: synthetic peptide directed towards the middle region of human NOTCH4. Synthetic peptide located within the following region: KALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGAL

Rabbit Polyclonal Anti-NOTCH4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NOTCH4 antibody: synthetic peptide directed towards the C terminal of human NOTCH4. Synthetic peptide located within the following region: CDWVALGACGSASNIPIPPPCLTPSPERGSPQLDCGPPALQEMPINQGGE

Anti-NOTCH4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from C' 1989-2003 amino acids of Human notch 4

Rabbit Polyclonal anti-NOTCH4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human NOTCH4

Rabbit Polyclonal anti-NOTCH4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human NOTCH4