NOTCH4 Rabbit Polyclonal Antibody
Other products for "NOTCH4"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NOTCH4 antibody: synthetic peptide directed towards the C terminal of human NOTCH4. Synthetic peptide located within the following region: CDWVALGACGSASNIPIPPPCLTPSPERGSPQLDCGPPALQEMPINQGGE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 58 kDa |
Gene Name | notch 4 |
Database Link | |
Background | NOTCH4 is a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. NOTCH4 is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. NOTCH4 functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. NOTCH4 gene may be associated with susceptibility to schizophrenia in a small portion of cases. |
Synonyms | INT3 |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 92%; Guinea pig: 92% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Dorso-ventral axis formation, Notch signaling pathway |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.