Primary Antibodies

View as table Download

Rabbit Polyclonal Alas1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A portion of amino acids 480-530 of human ALAS-1 were used as the immunogen.

Rabbit Polyclonal Anti-ALAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALAS1 Antibody: synthetic peptide directed towards the N terminal of human ALAS1. Synthetic peptide located within the following region: ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS

Carrier-free (BSA/glycerol-free) ALAS1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALAS1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ALAS1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 219 amino acids of human aminolevulinate, delta-, synthase 1

Anti-ALAS1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 219 amino acids of human aminolevulinate, delta-, synthase 1

ALAS1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ALAS1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ALAS1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ALAS1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ALAS1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ALAS1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ALAS1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ALAS1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated