Primary Antibodies

View as table Download

PDE3A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Immunogen PDE3A antibody was raised against synthetic 19 amino acid peptide from near N-terminus of human PDE3A. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (94%).

PDE3A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Immunogen PDE3A antibody was raised against synthetic 18 amino acid peptide from N-terminus of human PDE3A. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey (94%); Horse (83%).

PDE3A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human, Monkey, Mouse, Rat, Horse, Gibbon
Immunogen PDE3A antibody was raised against synthetic 17 amino acid peptide from internal region of human PDE3A. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Horse, Opossum (100%); Chicken (88%).

Rabbit Polyclonal Anti-PDE3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE3A antibody: synthetic peptide directed towards the N terminal of human PDE3A. Synthetic peptide located within the following region: LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD