Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-LIPT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIPT1 antibody: synthetic peptide directed towards the N terminal of human LIPT1. Synthetic peptide located within the following region: NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE

Rabbit Polyclonal Anti-LIAS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIAS antibody: synthetic peptide directed towards the C terminal of human LIAS. Synthetic peptide located within the following region: EYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK

Rabbit Polyclonal Anti-LIAS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIAS antibody: synthetic peptide directed towards the N terminal of human LIAS. Synthetic peptide located within the following region: LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG

Rabbit polyclonal Anti-LIPT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LIPT2 antibody is: synthetic peptide directed towards the C-terminal region of Human LIPT2. Synthetic peptide located within the following region: TDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCT

Rabbit polyclonal antibody to Lipoic acid synthetase (lipoic acid synthetase)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 54 and 258 of Lipoic acid synthetase (Uniprot ID#O43766)

Rabbit polyclonal Anti-LIPT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LIPT2 antibody is: synthetic peptide directed towards the C-terminal region of Human LIPT2. Synthetic peptide located within the following region: KICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQ