LIPT2 Rabbit Polyclonal Antibody

CAT#: TA331040

Rabbit polyclonal Anti-LIPT2 Antibody

Product Images

Host: Rabbit; Target Name: LIPT2; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LIPT2 antibody is: synthetic peptide directed towards the C-terminal region of Human LIPT2. Synthetic peptide located within the following region: KICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: lipoyl(octanoyl) transferase 2 (putative)
• Database Link:
  NP_001138341
  Entrez Gene 387787 Human
  UniProt ID A6NK58
• Background: LIPT2 catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.
• Synonyms: LIPT2
• Note: Pig: 93%; Rat: 93%; Human: 93%; Guinea pig: 93%; Mouse: 92%; Dog: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Zebrafish: 79%

Reference Data

• Protein Pathways: Lipoic acid metabolism, Metabolic pathways