Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TMLHE Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Tmlhe antibody is: synthetic peptide directed towards the C-terminal region of Rat Tmlhe. Synthetic peptide located within the following region: ELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARILG

Rabbit Polyclonal Anti-TMLHE Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMLHE antibody: synthetic peptide directed towards the middle region of human TMLHE. Synthetic peptide located within the following region: PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV

TMLHE (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 123-153 amino acids from the N-terminal region of human TMLHE

Rabbit polyclonal antibody to TMLHE (trimethyllysine hydroxylase, epsilon)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 115 and 397 of TMLHE (Uniprot ID#Q9NVH6)