TMLHE Rabbit Polyclonal Antibody

CAT#: TA344913

Rabbit Polyclonal Anti-TMLHE Antibody - middle region

Product Images

WB Suggested Anti-TMLHE Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMLHE antibody: synthetic peptide directed towards the middle region of human TMLHE. Synthetic peptide located within the following region: PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: trimethyllysine hydroxylase, epsilon
• Database Link:
  NP_060666
  Entrez Gene 55217 Human
  UniProt ID Q9NVH6
• Background: This gene encodes the protein trimethyllysine dioxygenase which is the first enzyme in the carnitine biosynthesis pathway. Carnitine play an essential role in the transport of activated fatty acids across the inner mitochondrial membrane. The encoded prot
• Synonyms: AUTSX6; BBOX2; TMLD; TMLH; TMLHED; XAP130
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86%

Reference Data

• Protein Pathways: Lysine degradation