Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to AP4M1 (adaptor-related protein complex 4, mu 1 subunit)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 70 and 295 of AP4M1 (Uniprot ID#O00189)

Rabbit Polyclonal Anti-AP4M1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AP4M1 Antibody is: synthetic peptide directed towards the C-terminal region of Human AP4M1. Synthetic peptide located within the following region: QELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLS