Primary Antibodies

View as table Download

Rabbit polyclonal Anti-ATP6V0D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V0D2 antibody: synthetic peptide directed towards the middle region of human ATP6V0D2. Synthetic peptide located within the following region: MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI

Rabbit polyclonal Anti-ATP6V0D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V0D2 antibody: synthetic peptide directed towards the middle region of human ATP6V0D2. Synthetic peptide located within the following region: GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM

Carrier-free (BSA/glycerol-free) ATP6V0D2 mouse monoclonal antibody,clone OTI2D6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATP6V0D2 mouse monoclonal antibody,clone OTI2D6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATP6V0D2 mouse monoclonal antibody,clone OTI2D6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated