Primary Antibodies

Jump to Filters
View as table Download
GGA3 (702-713) Goat Polyclonal Antibody
AP22476PU-N

USD 440.00

2 Weeks

GGA3 (702-713) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bat, Equine, Human, Monkey, Porcine, Rabbit
Immunogen Synthetic peptide from (C-term) of human GGA3
GGA3 Rabbit Polyclonal Antibody
TA333540

USD 375.00

5 Days

Rabbit Polyclonal Anti-GGA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GGA3 Antibody: synthetic peptide directed towards the N terminal of human GGA3. Synthetic peptide located within the following region: AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLL
GGA3 Rabbit Polyclonal Antibody
TA319379

USD 530.00

5 Days

Rabbit polyclonal anti-GGA3 antibody

Applications WB
Reactivities Chimpanzee, Human
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 400-415 of Human GGA3.