GGA3 Rabbit Polyclonal Antibody

CAT#: TA333540

Rabbit Polyclonal Anti-GGA3 Antibody

Product Images

WB Suggested Anti-GGA3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GGA3 Antibody: synthetic peptide directed towards the N terminal of human GGA3. Synthetic peptide located within the following region: AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: golgi associated, gamma adaptin ear containing, ARF binding protein 3
• Database Link:
  NP_619525
  Entrez Gene 23163 Human
  UniProt ID Q9NZ52
• Background: This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. Multiple alternatively spliced transcript variants have been identified in this gene. [provided by RefSeq, Feb 2010]
• Synonyms: KIAA0154
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Lysosome