Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-Gps2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gps2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gps2. Synthetic peptide located within the following region: LKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLNMQGSPGGHN

Rabbit Polyclonal Anti-NCR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NCR1