Primary Antibodies

Jump to Filters
View as table Download
Metabotropic Glutamate Receptor 6 (GRM6) Rabbit Polyclonal Antibody
TA330620

USD 375.00

5 Days

Rabbit Polyclonal Anti-GRM6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the C terminal of human GRM6. Synthetic peptide located within the following region: ITFSLTSLQVVGMIAWLGARPPHSVIDYEEQRTVDPEQARGVLKCDMSDL